A9210
NPL Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9210
- Additional Names:
- C112|C1orf13|NAL|NPL|NPL1
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQ
- Uniprot:
- Q9BXD5
- Synonyms:
- C112;C1orf13;dihydrodipicolinate synthetase homolog 1;N-acetylneuraminate lyase;N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase);N-acetylneuraminate pyruvate-lyase;N-acetylneuraminic acid aldolase;NAL;NALase;NPL1;Sialate lyase;sialate-pyruvate lyase;sialic acid aldolase;Sialic acid lyase
- Extra Details:
- This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha)(8)-barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice