FGFR4 Rabbit monoclonal antibody

Size

POA

SKU:: A9197
Additional Names:: CD334|FGFR4|JTK2|TKF
Application:: ELISA, WB
Molecular Weight:: 95 kDa/125 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT
Uniprot:: P22455
Synonyms:: CD334;fibroblast growth factor receptor 4;hydroxyaryl-protein kinase;JTK2;protein-tyrosine kinase;TKF;tyrosine kinase related to fibroblast growth factor receptor;tyrosylprotein kinase
Extra Details:: The protein encoded by this gene is a tyrosine kinase and cell surface receptor for fibroblast growth factors. The encoded protein is involved in the regulation of several pathways, including cell proliferation, cell differentiation, cell migration, lipid metabolism, bile acid biosynthesis, vitamin D metabolism, glucose uptake, and phosphate homeostasis. This protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment, and a cytoplasmic tyrosine kinase domain. The extracellular portion interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation.

Shipping Conditions:: Blue Ice