A9192
RPL26L1 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9192
- Additional Names:
- RPL26L1|RPL26P1
- Application:
- ELISA, WB
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
- Uniprot:
- Q9UNX3
- Synonyms:
- 60S ribosomal protein L26-like 1;large ribosomal subunit protein uL24-like 1;ribosomal protein L26 homolog;ribosomal protein L26 pseudogene 1;RPL26P1
- Extra Details:
- This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein.
- Shipping Conditions:
- Blue Ice