A9180
Mesothelin Rabbit monoclonal antibody
Size
POA
- SKU:
- A9180
- Additional Names:
- Mesothelin|MPF|SMRP
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 40-50kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS
- Uniprot:
- Q13421
- Synonyms:
- CAK1 antigen;megakaryocyte potentiating factor;mesothelin;MPF;pre-pro-megakaryocyte-potentiating factor;SMRP;soluble MPF mesothelin related protein
- Extra Details:
- This gene encodes a preproprotein that is proteolytically processed to generate two protein products, megakaryocyte potentiating factor and mesothelin. Megakaryocyte potentiating factor functions as a cytokine that can stimulate colony formation of bone marrow megakaryocytes. Mesothelin is a glycosylphosphatidylinositol-anchored cell-surface protein that may function as a cell adhesion protein. This protein is overexpressed in epithelial mesotheliomas, ovarian cancers and in specific squamous cell carcinomas. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
- Shipping Conditions:
- Blue Ice