A9178
ATP5L Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A9178
- Additional Names:
- ATP5JG|ATP5L
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 11kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV
- Uniprot:
- O75964
- Synonyms:
- ATP synthase g chain, mitochondrial;ATP synthase subunit g, mitochondrial;ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G;ATP synthase, H+ transporting, mitochondrial F1F0, subunit g;ATP synthase, H+ transporting, mitochondrial Fo complex subunit G;ATP5JG;ATP5L;ATPase subunit G;F1F0-type ATP synthase subunit g;F1Fo-ATP synthase complex Fo membrane domain g subunit
- Extra Details:
- Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the g subunit of the Fo complex. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice







