A9152
14-3-3 beta/zeta Rabbit monoclonal antibody
Size
POA
- SKU:
- A9152
- Additional Names:
- 14-3-3|14-3-3 beta/zeta|GW128|HEL-S-1|HS1|KCIP-1|YWHAA
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL
- Uniprot:
- P31946, P63104
- Synonyms:
- 14-3-3 alpha;14-3-3 delta;14-3-3 protein beta/alpha;14-3-3 protein zeta/delta;14-3-3 protein/cytosolic phospholipase A2;14-3-3 zeta;14-3-3-zeta;epididymis luminal protein 4;epididymis secretory protein Li 1;epididymis secretory protein Li 3;epididymis secretory protein Li 93;GW128;HEL-S-1;HEL-S-3;HEL-S-93;HEL4;HS1;KCIP-1;phospholipase A2;POPCHAS;protein 1054;Protein kinase C inhibitor protein 1;protein kinase C inhibitor protein-1;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alpha polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide;YWHAA;YWHAD
- Extra Details:
- This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]
- Shipping Conditions:
- Blue Ice