A9135
ABCE1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A9135
- Additional Names:
- ABC38|ABCE1|OABP|RLI|RLI1|RNASEL1|RNASELI|RNS4I
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 67kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
- Uniprot:
- P61221
- Synonyms:
- 2'-5'-oligoadenylate-binding protein;ABC38;ATP-binding cassette sub-family E member 1;ATP-binding cassette, sub-family E (OABP), member 1;huHP68;OABP;ribonuclease 4 inhibitor;ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) inhibitor;RLI;RLI1;RNase L inhibitor;RNase L inhibitor 1;RNASEL1;RNASELI;RNS4I
- Extra Details:
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene.
- Shipping Conditions:
- Blue Ice