Ephrin A1 Rabbit monoclonal antibody

Size

POA

SKU:: A9132
Additional Names:: B61|ECKLG|EFL1|Ephrin A1|EPLG1|GMAN|LERK-1|LERK1|TNFAIP4
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 24kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHG
Uniprot:: P20827
Synonyms:: B61;ECKLG;EFL1;eph-related receptor tyrosine kinase ligand 1;ephrin-A1;epididymis secretory sperm binding protein;EPLG1;gastric cancer metastasis associated long noncoding RNA;GMAN;immediate early response protein B61;LERK-1;LERK1;ligand of eph-related kinase 1;TNF alpha-induced protein 4;TNFAIP4;Tumor necrosis factor alpha-induced protein 4;tumor necrosis factor, alpha-induced protein 4
Extra Details:: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.

Shipping Conditions:: Blue Ice