Peroxiredoxin 4 (PRDX4) Rabbit monoclonal antibody

Size

POA

SKU:: A9131
Additional Names:: AOE37-2|AOE372|HEL-S-97n|Peroxiredoxin 4 (PRDX4)|PRX-4
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 27kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE
Uniprot:: Q13162
Synonyms:: antioxidant enzyme AOE372;AOE37-2;AOE372;epididymis secretory sperm binding protein Li 97n;HEL-S-97n;peroxiredoxin IV;peroxiredoxin-4;PRX-4;prx-IV;thioredoxin peroxidase (antioxidant enzyme);thioredoxin peroxidase AO372;thioredoxin-dependent peroxide reductase A0372;thioredoxin-dependent peroxiredoxin 4
Extra Details:: The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.