p70 S6 Kinase 2 Rabbit monoclonal antibody

Size

POA

SKU:: A9100
Additional Names:: KLS|p70 S6 Kinase 2|P70-beta|P70-beta-1|P70-beta-2|p70(S6K)-beta|p70S6Kb|S6K-beta2|S6K2|S6KB|S6Kbeta|S6KI(2)|SRK|STK14B
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 53 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
Uniprot:: Q9UBS0
Synonyms:: 70 kDa ribosomal protein S6 kinase 2;KLS;p70 ribosomal S6 kinase beta;p70 S6 kinase beta;p70 S6K-beta;p70 S6KB;P70-beta;P70-beta-1;P70-beta-2;p70-S6K 2;p70(S6K)-beta;P70S6K2;p70S6Kb;ribosomal protein S6 kinase beta-2;ribosomal protein S6 kinase, 70kDa, polypeptide 2;S6 kinase-related kinase;S6K-beta;S6K-beta-2;S6K-beta2;S6K2;S6KB;S6Kbeta;S6KI(2);serine/threonine-protein kinase 14 beta;serine/threonine-protein kinase 14B;SRK;STK14B
Extra Details:: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.

Shipping Conditions:: Blue Ice