A9090
FKBP51/FKBP5 Rabbit monoclonal antibody
Size
POA
- SKU:
- A9090
- Additional Names:
- AIG6|FKBP51|FKBP51/FKBP5|FKBP54|P54|PPIase|Ptg-10
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 51kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
- Uniprot:
- Q13451
- Synonyms:
- 51 kDa FK506-binding protein;51 kDa FKBP;54 kDa progesterone receptor-associated immunophilin;AIG6;androgen-regulated protein 6;FF1 antigen;FK506 binding protein 5;FK506-binding protein 5;FKBP-51;FKBP51;FKBP54;HSP90-binding immunophilin;P54;peptidyl-prolyl cis-trans isomerase FKBP5;peptidylprolyl cis-trans isomerase;PPIase;PPIase FKBP5;Ptg-10;rotamase;T-cell FK506-binding protein
- Extra Details:
- The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice