A9078
NEDD4L Rabbit monoclonal antibody

Size
POA
- SKU:
- A9078
- Additional Names:
- hNEDD4-2|NEDD4-2|NEDD4.2|NEDD4L|PVNH7|RSP5
- Application:
- ELISA, WB
- Molecular Weight:
- 135kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD
- Uniprot:
- Q96PU5
- Synonyms:
- E3 ubiquitin-protein ligase NEDD4-like;HECT-type E3 ubiquitin transferase NED4L;hNEDD4-2;NEDD4-2;NEDD4.2;neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase;PVNH7;RSP5;ubiquitin-protein ligase Rsp5
- Extra Details:
- This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein mediates the ubiquitination of multiple target substrates and plays a critical role in epithelial sodium transport by regulating the cell surface expression of the epithelial sodium channel, ENaC. Single nucleotide polymorphisms in this gene may be associated with essential hypertension. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice

