A9074
FKBP1B Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A9074
- Additional Names:
- FKBP12.6|FKBP1B|FKBP1L|OTK4|PKBP1L|PPIase
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 13kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
- Uniprot:
- P68106
- Synonyms:
- 12.6 kDa FK506-binding protein;12.6 kDa FKBP;calstabin 2;FK506 binding protein 1B, 12.6 kDa;FK506-binding protein 12.6;FK506-binding protein 1B;FKBP-12.6;FKBP-1B;FKBP12.6;FKBP1L;h-FKBP-12;immunophilin FKBP12.6;OTK4;peptidyl-prolyl cis-trans isomerase FKBP1B;PKBP1L;PPIase;PPIase FKBP1B;rotamase
- Extra Details:
- The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
- Shipping Conditions:
- Blue Ice

