A9072
FHIT Rabbit monoclonal antibody

Size
POA
- SKU:
- A9072
- Additional Names:
- AP3Aase|FHIT|FRA3B
- Application:
- ELISA, WB
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVL
- Uniprot:
- P49789
- Synonyms:
- AP3A hydrolase;AP3Aase;bis(5'-adenosyl)-triphosphatase;diadenosine 5',5'''-P1,P3-triphosphate hydrolase;dinucleosidetriphosphatase;FRA3B;Fragile histidine triad protein
- Extra Details:
- The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage.
- Shipping Conditions:
- Blue Ice

