A9059
macroH2A.1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A9059
- Additional Names:
- H2A.y|H2A/y|H2AF12M|H2AFY|macroH2A.1|MACROH2A1.1|macroH2A1.2|mH2A1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 40kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL
- Uniprot:
- O75367
- Synonyms:
- core histone macro-H2A.1;H2A histone family member Y;H2A.y;H2A/y;H2AF12M;H2AFY;histone H2A.y;histone macroH2A1;histone macroH2A1.1;histone macroH2A1.2;MACROH2A1.1;macroH2A1.2;medulloblastoma antigen MU-MB-50.205;mH2A1
- Extra Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice







