macroH2A.1 Rabbit monoclonal antibody

Size

POA

SKU:: A9059
Additional Names:: H2A.y|H2A/y|H2AF12M|H2AFY|macroH2A.1|MACROH2A1.1|macroH2A1.2|mH2A1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 40kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL
Uniprot:: O75367
Synonyms:: core histone macro-H2A.1;H2A histone family member Y;H2A.y;H2A/y;H2AF12M;H2AFY;histone H2A.y;histone macroH2A1;histone macroH2A1.1;histone macroH2A1.2;MACROH2A1.1;macroH2A1.2;medulloblastoma antigen MU-MB-50.205;mH2A1
Extra Details:: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Shipping Conditions:: Blue Ice