A9056
DDOST Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A9056
- Additional Names:
- AGER1|CDG1R|DDOST|GATD6|OKSWcl45|OST|OST48|WBP1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 48kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VCASGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVF
- Uniprot:
- P39656
- Synonyms:
- advanced glycation end-product receptor 1;advanced glycation endproduct receptor 1;AGER1;CDG1R;dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit;dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic);dolichyl-diphosphooligosaccharide-protein glycotransferase;GATD6;OKSWcl45;oligosaccharyl transferase 48 kDa subunit;oligosaccharyltransferase 48 kDa subunit;oligosaccharyltransferase subunit 48;OST;OST48;WBP1
- Extra Details:
- This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia.
- Shipping Conditions:
- Blue Ice