MGEA5 Rabbit polyclonal antibody

Size

£151.00

SKU:: A9033
Additional Names:: MEA5|MGEA5|NCOAT
Application:: ELISA, WB, IHC-P
Molecular Weight:: 130kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCAN
Uniprot:: O60502
Synonyms:: beta-hexosaminidase;beta-N-acetylglucosaminidase;beta-N-acetylhexosaminidase;bifunctional protein NCOAT;hyaluronidase in meningioma;MEA5;meningioma expressed antigen 5 (hyaluronidase);meningioma-expressed antigen 5;MGEA5;N-acetyl-beta-D-glucosaminidase;N-acetyl-beta-glucosaminidase;NCOAT;nuclear cytoplasmic O-GlcNAcase and acetyltransferase;protein O-GlcNAcase
Extra Details:: The dynamic modification of cytoplasmic and nuclear proteins by O-linked N-acetylglucosamine (O-GlcNAc) addition and removal on serine and threonine residues is catalyzed by OGT (MIM 300255), which adds O-GlcNAc, and MGEA5, a glycosidase that removes O-GlcNAc modifications (Gao et al., 2001 [PubMed 11148210]).