A9018
IGFBP2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A9018
- Additional Names:
- IBP2|IGF-BP53|IGFBP2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ
- Uniprot:
- P18065
- Synonyms:
- IBP2;IGF-binding protein 2;IGF-BP53;insulin-like growth factor binding protein 2, 36kDa;insulin-like growth factor-binding protein 2
- Extra Details:
- The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene.
- Shipping Conditions:
- Blue Ice



