MYO18A Rabbit polyclonal antibody

Size

£151.00

SKU:: A9015
Additional Names:: MAJN|MYO18A|MYSPDZ|SP-R210|SPR210|TIAF1
Application:: ELISA, WB
Molecular Weight:: 260kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA
Uniprot:: Q92614
Synonyms:: MAJN;molecule associated with JAK3 N-terminus;myosin 18A;myosin containing a PDZ domain;myosin containing PDZ domain;MYSPDZ;SP-A receptor subunit SP-R210 alphaS;SP-R210;SPR210;surfactant protein receptor SP-R210;unconventional myosin-XVIIIa
Extra Details:: The protein encoded by this gene can bind GOLPH3, linking the Golgi to the cytoskeleton and influencing Golgi membrane trafficking. The encoded protein is also part of a complex that assembles lamellar actomyosin bundles and may be required for cell migration.