CXCR5 Rabbit monoclonal antibody

Size

POA

SKU:: A8950
Additional Names:: BLR1|CD185|CXCR5|MDR15
Application:: ELISA, WB, IF
Molecular Weight:: 42 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF
Uniprot:: P32302
Synonyms:: BLR1;Burkitt lymphoma receptor 1;Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif) receptor 5);Burkitt lymphoma receptor 1, GTP-binding protein;C-X-C chemokine receptor type 5;CD185;chemokine (C-X-C motif) receptor 5;CXC-R5;CXCR-5;MDR-15;MDR15;monocyte-derived receptor 15
Extra Details:: This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.