A8877
VAMP1 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8877
- Additional Names:
- CMS25|SAX1|SPAX1|SYB1|VAMP-1|VAMP1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK
- Uniprot:
- P23763
- Synonyms:
- CMS25;SPAX1;SYB1;Synaptobrevin-1;VAMP-1;vesicle-associated membrane protein 1;vesicle-associated membrane protein 1 (synaptobrevin 1)
- Extra Details:
- Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined.
- Shipping Conditions:
- Blue Ice