HDGFRP3 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8815
Additional Names:: CGI-142|HDGF-2|HDGF2|HDGFRP3|HRP-3
Application:: ELISA, WB, IHC-P
Molecular Weight:: 28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT
Synonyms:: CGI-142;HDGF-2;HDGF2;HDGFRP3;hepatoma-derived growth factor 2;hepatoma-derived growth factor-related protein 3;hepatoma-derived growth factor, related protein 3;HRP-3
Extra Details:: Predicted to enable double-stranded DNA binding activity; microtubule binding activity; and transcription coregulator activity. Predicted to be involved in several processes, including microtubule polymerization; negative regulation of microtubule depolymerization; and neuron projection development. Located in nucleoplasm.