A8813
AMHR2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A8813
- Additional Names:
- AMHR|AMHR2|MISR2|MISRII|MRII
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGESIWMALV
- Uniprot:
- Q16671
- Synonyms:
- AMH type II receptor;AMHR;anti-Muellerian hormone type II receptor;anti-Muellerian hormone type-2 receptor;anti-Mullerian hormone receptor, type II;MIS type II receptor;MISR2;MISRII;MRII;Muellerian inhibiting substance type II receptor;Mullerian inhibiting substance type II receptor
- Extra Details:
- This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice

