A8798
Complement factor H Rabbit monoclonal antibody

Size
POA
- SKU:
- A8798
- Additional Names:
- AHUS1|AMBP1|ARMD4|ARMS1|CFHL3|Complement factor H|FH|FHL1|HF|HF1|HF2|HUS
- Application:
- ELISA, WB
- Molecular Weight:
- 139kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSK
- Uniprot:
- P08603
- Synonyms:
- adrenomedullin binding protein;age-related maculopathy susceptibility 1;AHUS1;AMBP1;ARMD4;ARMS1;beta-1-H-globulin;beta-1H;CFHL3;complement factor H;factor H;factor H-like 1;FH;FHL1;H factor 1;H factor 1 (complement);H factor 2 (complement);HF;HF1;HF2;HUS
- Extra Details:
- This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Shipping Conditions:
- Blue Ice

