Complement factor H Rabbit monoclonal antibody

Size

POA

SKU:: A8798
Additional Names:: AHUS1|AMBP1|ARMD4|ARMS1|CFHL3|Complement factor H|FH|FHL1|HF|HF1|HF2|HUS
Application:: ELISA, WB
Molecular Weight:: 139kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSK
Uniprot:: P08603
Synonyms:: adrenomedullin binding protein;age-related maculopathy susceptibility 1;AHUS1;AMBP1;ARMD4;ARMS1;beta-1-H-globulin;beta-1H;CFHL3;complement factor H;factor H;factor H-like 1;FH;FHL1;H factor 1;H factor 1 (complement);H factor 2 (complement);HF;HF1;HF2;HUS
Extra Details:: This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.