A8795
MSH6 Rabbit monoclonal antibody

Size
POA
- SKU:
- A8795
- Additional Names:
- GTBP|GTMBP|HNPCC5|HSAP|LYNCH5|MMRCS3|MSH-6|MSH6|p160
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 160kDa/153kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKM
- Uniprot:
- P52701
- Synonyms:
- DNA mismatch repair protein Msh6;G/T mismatch-binding protein;GTBP;GTMBP;HNPCC5;HSAP;MMRCS3;mutS protein homolog 6;mutS-alpha 160 kDa subunit;p160;sperm-associated protein
- Extra Details:
- This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice





