A8782
BRF2 Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8782
- Additional Names:
- BRF2|BRFU|TFIIIB50
- Application:
- ELISA, WB
- Molecular Weight:
- 62kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP
- Uniprot:
- Q9HAW0
- Synonyms:
- B-related factor 2;BRF-2;BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit;BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like;BRFU;hBRFU;hTFIIIB50;RNA polymerase III transcription initiation factor BRFU;TFIIIB50;transcription factor IIB- related factor, TFIIIB50;transcription factor IIIB 50 kDa subunit
- Extra Details:
- This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein.
- Shipping Conditions:
- Blue Ice

