A8762
CRNN Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8762
- Additional Names:
- C1orf10|CRNN|DRC1|PDRC1|SEP53
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GETVPGGQAQTGASTESGRQEWSSTHPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYLRSTKP
- Uniprot:
- Q9UBG3
- Synonyms:
- 53 kDa putative calcium-binding protein;53 kDa squamous epithelial-induced stress protein;58 kDa heat shock protein;C1orf10;cornulin;DRC1;PDRC1;SEP53;squamous epithelial heat shock protein 53;tumor-related protein
- Extra Details:
- This gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.
- Shipping Conditions:
- Blue Ice