RanGAP1 Rabbit monoclonal antibody

Size

POA

SKU:: A8758
Additional Names:: Fug1|RANGAP|RanGAP1|SD
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 68kDa/90kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPAL
Uniprot:: P46060
Synonyms:: Fug1;ran GTPase-activating protein 1;RANGAP;SD;segregation distorter homolog
Extra Details:: This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants.