PUS1 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8720
Additional Names:: MLASA1|PUS1
Application:: ELISA, WB
Molecular Weight:: 47kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTIIGTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD
Uniprot:: Q9Y606
Synonyms:: mitochondrial tRNA pseudouridine synthase A;MLASA1;pseudouridylate synthase 1;tRNA pseudouridine synthase A;tRNA pseudouridine synthase A, mitochondrial;tRNA pseudouridine(38-40) synthase;tRNA pseudouridylate synthase I;tRNA uridine isomerase I;tRNA-uridine isomerase I
Extra Details:: This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.