TIMM23 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8688
Additional Names:: TIM23|TIMM23
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGR
Uniprot:: O14925
Synonyms:: mitochondrial import inner membrane translocase subunit Tim23;TIM23;translocase of inner mitochondrial membrane 23 homolog;translocase of the inner mitochondrial membrane
Extra Details:: The protein encoded by this gene is part of a complex located in the inner mitochondrial membrane that mediates the transport of transit peptide-containing proteins across the membrane. Multiple transcript variants, one protein-coding and others not protein-coding, have been found for this gene.