A8673
ABHD5 Rabbit monoclonal antibody

Size
POA
- SKU:
- A8673
- Additional Names:
- ABHD5|CGI58|IECN2|NCIE2
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRA
- Uniprot:
- Q8WTS1
- Synonyms:
- 1-acylglycerol-3-phosphate O-acyltransferase ABHD5;abhydrolase domain-containing protein 5;CGI58;IECN2;lipid droplet-binding protein CGI-58;NCIE2;truncated abhydrolase domain-containing protein 5
- Extra Details:
- The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
- Shipping Conditions:
- Blue Ice

