SOX10 Rabbit monoclonal antibody

Size

POA

SKU:: A8658
Additional Names:: DOM|PCWH|SOX-10|SOX10|WS2E|WS4|WS4C
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 62-75 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSH
Uniprot:: P56693
Synonyms:: DOM;dominant megacolon, mouse, human homolog of;PCWH;SRY (sex determining region Y)-box 10;SRY-box 10;SRY-related HMG-box gene 10;transcription factor SOX-10;WS2E;WS4;WS4C
Extra Details:: This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.