A8657
Septin 9 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8657
- Additional Names:
- AF17q25|MSF|MSF1|NAPB|PNUTL4|SEPT9|SeptD1|Septin 9|SINT1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPV
- Uniprot:
- Q9UHD8
- Synonyms:
- AF17q25;MLL septin-like fusion protein MSF-A;MSF;MSF1;NAPB;Ov/Br septin;ovarian/breast septin;PNUTL4;SEPT9;SeptD1;septin D1;septin-9;SINT1
- Extra Details:
- This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice