EIF3J Rabbit polyclonal antibody

Size

£151.00

SKU:: A8637
Additional Names:: eIF3-alpha|eIF3-p35|EIF3J|EIF3S1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Uniprot:: O75822
Synonyms:: eIF-3-alpha;eIF3 p35;eIF3-alpha;eIF3-p35;EIF3S1;Eukaryotic translation initiation factor 3 subunit 1;eukaryotic translation initiation factor 3 subunit J;eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD)
Extra Details:: This gene encodes a core subunit of the eukaryotic initiation factor 3 complex, which participates in the initiation of translation by aiding in the recruitment of protein and mRNA components to the 40S ribosome. There are pseudogenes for this gene on chromosomes 1, 3, and 9. Alternative splicing results in multiple transcript variants encoding different isoforms.