A8634
BPIFA1 Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8634
- Additional Names:
- bA49G10.5|BPIFA1|LUNX|NASG|PLUNC|SPLUNC1|SPURT
- Application:
- ELISA, WB
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
- Uniprot:
- Q9NP55
- Synonyms:
- bA49G10.5;BPI fold-containing family A member 1;ligand-binding protein RYA3;lung-specific protein X;LUNX;NASG;nasopharyngeal carcinoma-related protein;palate lung and nasal epithelium clone protein;palate, lung and nasal epithelium associated;PLUNC;protein Plunc;secretory protein in upper respiratory tracts;short PLUNC1;SPLUNC1;SPURT;tracheal epithelium enriched protein;Tracheal epithelium-enriched protein;von Ebner protein Hl
- Extra Details:
- This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known.
- Shipping Conditions:
- Blue Ice

