A8627
CD320 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8627
- Additional Names:
- 8D6|8D6A|CD320|sCD320|TCBLR|TCII-R|TCN2R
- Application:
- ELISA, WB
- Molecular Weight:
- 58-70kDaa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY
- Uniprot:
- Q9NPF0
- Synonyms:
- 8D6;8D6 antigen;8D6A;CD320 antigen;FDC-signaling molecule 8D6;FDC-SM-8D6;TCBLR;TCN2R;transcobalamin 2 receptor;transcobalamin receptor
- Extra Details:
- This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice