[KO Validated] GDI2 Rabbit polyclonal antibody

Size

POA

SKU:: A8615
Additional Names:: HEL-S-46e|I2|RABGDIB
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 51kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Uniprot:: P50395
Synonyms:: epididymis secretory sperm binding protein Li 46e;GDI-2;guanosine diphosphate dissociation inhibitor 2;HEL-S-46e;rab GDI beta;rab GDP dissociation inhibitor beta;rab GDP-dissociation inhibitor, beta;RABGDIB
Extra Details:: GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.