KCNK9 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8609
Additional Names:: BIBARS|K2p9.1|KCNK9|KT3.2|TASK-3|TASK3|TASK32
Application:: ELISA, WB
Molecular Weight:: 42kDa/53kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAA
Uniprot:: Q9NPC2
Synonyms:: acid-sensitive potassium channel protein TASK-3;BIBARS;K2p9.1;KT3.2;potassium 2-pore domain leak channel TASK3;potassium channel subfamily K member 9;potassium channel, two pore domain subfamily K, member 9;TASK-3;TASK3;TASK32;TWIK-related acid-sensitive K(+) channel 3;TWIK-related acid-sensitive K+ 3;two pore K(+) channel KT3.2;two pore potassium channel KT3.2
Extra Details:: This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinomas. This gene is imprinted in the brain, with preferential expression from the maternal allele. A mutation in this gene was associated with Birk-Barel dysmorphism syndrome. Alternative splicing results in multiple transcript variants.