HOXA10 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8550
Additional Names:: HOX1|HOX1.8|HOX1H|HOXA10|PL
Application:: ELISA, WB
Molecular Weight:: 53kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSG
Uniprot:: P31260
Synonyms:: homeo box A10;homeobox protein 1H;homeobox protein Hox-1.8;homeobox protein Hox-1H;homeobox protein Hox-A10;homeobox protein HOXA10;HOX1;HOX1.8;HOX1H;PL
Extra Details:: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the downstream homeobox A9 (HOXA9) gene.