A8544
FCGRT Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8544
- Additional Names:
- alpha-chain|FcgammaRn|FCGRT|FCRN
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 40 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
- Uniprot:
- P55899
- Synonyms:
- alpha-chain;Fc fragment of IgG, receptor, transporter, alpha;FCRN;FcRn alpha chain;heavy chain of the major histocompatibility complex class I-like Fc receptor;IgG Fc fragment receptor transporter alpha chain;IgG receptor FcRn large subunit p51;immunoglobulin receptor, intestinal, heavy chain;major histocompatibility complex class I-like Fc receptor;neonatal Fc receptor;neonatal Fc-receptor for Ig;transmembrane alpha chain of the neonatal receptor
- Extra Details:
- This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice