A8533
CALCRL Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8533
- Additional Names:
- CALCRL|CGRPR|CRLR|LMPHM8
- Application:
- ELISA, WB
- Molecular Weight:
- 43kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
- Uniprot:
- Q16602
- Synonyms:
- calcitonin gene-related peptide type 1 receptor;calcitonin receptor-like;Calcitonin receptor-like receptor;CGRP type 1 receptor;CGRPR;CRLR;LMPHM8
- Extra Details:
- Enables adrenomedullin binding activity; adrenomedullin receptor activity; and calcitonin gene-related peptide receptor activity. Involved in several processes, including G protein-coupled receptor signaling pathway; cellular response to sucrose stimulus; and receptor internalization. Located in endoplasmic reticulum; endosome; and lysosome. Part of CGRP receptor complex and adrenomedullin receptor complex. Colocalizes with plasma membrane. Implicated in hereditary lymphedema.
- Shipping Conditions:
- Blue Ice