ULK1 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8529
Additional Names:: ATG1|ATG1A|hATG1|ULK1|UNC51|Unc51.1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 150kDa/140kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQS
Uniprot:: O75385
Synonyms:: ATG1;ATG1 autophagy related 1 homolog;ATG1A;autophagy-related protein 1 homolog;hATG1;serine/threonine-protein kinase ULK1;Unc-51-like kinase 1;UNC51;Unc51.1
Extra Details:: Enables identical protein binding activity; protein serine/threonine kinase activity; and small GTPase binding activity. Involved in several processes, including autophagosome assembly; positive regulation by symbiont of host autophagy; and protein phosphorylation. Located in autophagosome; cytosol; and phagophore assembly site membrane. Is extrinsic component of autophagosome membrane; extrinsic component of omegasome membrane; and extrinsic component of phagophore assembly site membrane. Part of Atg1/ULK1 kinase complex.