A8523
RMI2 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8523
- Additional Names:
- BLAP18|C16orf75|RMI2
- Application:
- ELISA, WB
- Molecular Weight:
- 16kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
- Uniprot:
- Q96E14
- Synonyms:
- BLAP18;BLM-associated protein of 18 kDa;C16orf75;recQ-mediated genome instability protein 2;RMI2, RecQ mediated genome instability 2, homolog
- Extra Details:
- RMI2 is a component of the BLM (RECQL3; MIM 604610) complex, which plays a role in homologous recombination-dependent DNA repair and is essential for genome stability (Xu et al., 2008 [PubMed 18923082]).
- Shipping Conditions:
- Blue Ice