A8517
RNF34 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8517
- Additional Names:
- CARP-1|CARP1|hRFI|RFI|RIF|RIFF|RNF34
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSAN
- Uniprot:
- Q969K3
- Synonyms:
- CARP-1;CARP1;caspase regulator CARP1;caspases-8 and -10-associated RING finger protein 1;E3 ubiquitin-protein ligase RNF34;FYVE-RING finger protein MOMO;hRFI;human RING finger homologous to inhibitor of apoptosis protein;RFI;RIF;RIFF;RING finger protein 34;ring finger protein 34, E3 ubiquitin protein ligase;RING finger protein RIFF;RING-type E3 ubiquitin transferase RNF34
- Extra Details:
- The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice