A8506
POLD4 Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8506
- Additional Names:
- p12|POLD4|POLDS
- Application:
- ELISA, WB
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
- Uniprot:
- Q9HCU8
- Synonyms:
- DNA polymerase delta smallest subunit p12;DNA polymerase delta subunit 4;DNA polymerase delta subunit p12;p12;POLDS;polymerase (DNA-directed), delta 4, accessory subunit;polymerase (DNA) delta 4, accessory subunit
- Extra Details:
- This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice