SMEK1 Rabbit polyclonal antibody

Size

£151.00

SKU:: A8500
Additional Names:: FLFL1|KIAA2010|MSTP033|PP4R3|PP4R3A|SMEK1|smk-1|smk1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS
Uniprot:: Q6IN85
Synonyms:: FLFL1;KIAA2010;MSTP033;PP4R3;PP4R3A;serine/threonine-protein phosphatase 4 regulatory subunit 3A;SMEK homolog 1;SMEK homolog 1, suppressor of mek1;SMEK1;smk-1;smk1
Extra Details:: Predicted to act upstream of or within positive regulation of gluconeogenesis and protein dephosphorylation. Located in cytosol and nuclear speck.