PPP2R3B Rabbit polyclonal antibody

Size

£151.00

SKU:: A8489
Additional Names:: NYREN8|PPP2R3B|PPP2R3L|PPP2R3LY|PR48|PR70
Application:: ELISA, WB
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Uniprot:: Q9Y5P8
Synonyms:: NY-REN-8 antigen;NYREN8;PP2A subunit B isoform PR48;PPP2R3L;PPP2R3LY;PR48;PR70;protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta;protein phosphatase 2, regulatory subunit B'', beta;Protein phosphatase 2A 48 kDa regulatory subunit;serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B;serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
Extra Details:: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''.

Shipping Conditions:: Blue Ice