A8488
TIMM10B Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8488
- Additional Names:
- FXC1|TIM10B|Tim9b|TIMM10B
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 24kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
- Uniprot:
- Q9Y5J6
- Synonyms:
- fracture callus 1 homolog;fracture callus protein 1;FXC1;mitochondrial import inner membrane translocase subunit Tim10 B;mitochondrial import inner membrane translocase subunit Tim9 B;TIM10B;Tim9b;TIMM10B;translocase of inner mitochondrial membrane 10 homolog B
- Extra Details:
- FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.
- Shipping Conditions:
- Blue Ice