A8485
KDM4C Rabbit polyclonal antibody

Size
£151.00
- SKU:
- A8485
- Additional Names:
- GASC1|JHDM3C|JMJD2C|KDM4C|TDRD14C
- Application:
- ELISA, WB
- Molecular Weight:
- 120kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYG
- Uniprot:
- Q9H3R0
- Synonyms:
- [histone H3]-trimethyl-L-lysine(9) demethylase 4C;GASC1;gene amplified in squamous cell carcinoma 1 protein;JHDM3C;JmjC domain-containing histone demethylation protein 3C;JMJD2C;jumonji domain-containing protein 2C;lysine (K)-specific demethylase 4C;lysine-specific demethylase 4C;TDRD14C;tudor domain containing 14C
- Extra Details:
- This gene is a member of the Jumonji domain 2 (JMJD2) family. The encoded protein is a trimethylation-specific demethylase, and converts specific trimethylated histone residues to the dimethylated form. This enzymatic action regulates gene expression and chromosome segregation. Chromosomal aberrations and changes in expression of this gene may be found in tumor cells. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

