A8476
INADL Rabbit polyclonal antibody
Size
£151.00
- SKU:
- A8476
- Additional Names:
- Cipp|hINADL|InaD-like|INADL
- Application:
- ELISA, WB
- Molecular Weight:
- 255kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VRRKTSSSTSPLEPPSDRGTVVEPLKPPALFLTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETEVDHNMDVNTEEDDDGELALW
- Uniprot:
- Q8NI35
- Synonyms:
- channel-interacting PDZ domain protein;channel-interacting PDZ domain-containing protein;Cipp;hINADL;inactivation no after-potential D-like protein;inactivation-no-afterpotential D-like;InaD-like;inaD-like protein;INADL;PALS1-associated tight junction protein;PDZ domain protein;protein associated to tight junctions
- Extra Details:
- This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.
- Shipping Conditions:
- Blue Ice